PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A13G2093
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bZIP
Protein Properties Length: 138aa    MW: 16062.5 Da    PI: 9.1819
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A13G2093genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.83.7e-1151104558
                  CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevak 58 
                  ++ +rk +NRe+ArrsR RKk+ ++ L+ +  +L + N++ +  l+   + +  
  Gh_A13G2093  51 RKRKRKVSNRESARRSRMRKKKHLDDLTAELTQLREDNHQIIMSLNITMQRYLH 104
                  6789***********************************999887766666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.6E-1247111IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.1284991IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1701.1E-949126No hitNo description
PfamPF001706.9E-95195IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.13E-1151103No hitNo description
CDDcd147021.83E-1552102No hitNo description
PROSITE patternPS0003605469IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 138 aa     Download sequence    Send to blast
MSQILSETFL SGFMILVQSL SVVFLYCGTS SGASTVTQVS EELQALLMEE RKRKRKVSNR  60
ESARRSRMRK KKHLDDLTAE LTQLREDNHQ IIMSLNITMQ RYLHVEAENS VLRAQTNELS  120
GRLESLEDII TFLQWKQW
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15055RKRKRK
25371KRKVSNRESARRSRMRKKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461770.15e-70PREDICTED: ocs element-binding factor 1-like
TrEMBLA0A0D2S7S32e-91A0A0D2S7S3_G
STRINGGLYMA04G01210.11e-38(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50128154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.18e-35basic leucine-zipper 44